- Frizzled-8 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-87410
- Human
- Frizzled-8
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- FZ-8, hFZ8
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- frizzled class receptor 8
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- GPCR, Growth and Development, Neuronal Cell Markers, Signal Transduction, Wnt Signaling Pathway
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: GSLYSDVSTG LTWRSGTASS VSYPKQMPLS QV
- 0.1 ml (also 25ul)
Sequence
GSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV
Specifications/Features
Available conjugates: Unconjugated